- Kv10.2 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-84934
- EAG2, H-EAG2, Kv10.2, hEAG2
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Kv10.2
- 0.1 ml (also 25ul)
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids: GDYEVIDEVT NTIQIDSWLY QLALSIGTPY RYNTSAGIWE GGPSKDS
- potassium voltage-gated channel subfamily H member 5
- Human (Hu)
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Apoptosis, Cancer, DNA Double Strand Break Repair, Protein Phosphatase, Signal Transduction, Tumor Suppressors
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- Rabbit
- PBS (pH 7.2) and 40% Glycerol
Sequence
GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS
Specifications/Features
Available conjugates: Unconjugated